PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007273P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 143aa    MW: 15908.3 Da    PI: 6.8615
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007273P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.72.9e-4256131176
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                     +Cq++gC+adl+ a+ yhrrhkvCe+h+ka+vv+++gleqrfCqqCsrfh++sefD++krsCr+rLa+hnerrrk 
  MELO3C007273P2  56 RCQADGCNADLTGARPYHRRHKVCEFHAKAAVVILAGLEQRFCQQCSRFHAVSEFDDTKRSCRSRLAGHNERRRKI 131
                     6*************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.0E-3549118IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.68454131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.85E-3955135IPR004333Transcription factor, SBP-box
PfamPF031104.3E-3357130IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MANSNDHSWE DMILDDDDDD DNDTEEVGFV DNERRRRSGL TTGRGGGGGG RSTVARCQAD  60
GCNADLTGAR PYHRRHKVCE FHAKAAVVIL AGLEQRFCQQ CSRFHAVSEF DDTKRSCRSR  120
LAGHNERRRK ILPDFHGQSS TN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3547130184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-173LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-173LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439842.11e-101PREDICTED: squamosa promoter-binding protein 1
SwissprotQ387415e-41SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A0A0KK741e-78A0A0A0KK74_CUCSA; Uncharacterized protein
STRINGVIT_10s0003g00050.t014e-42(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-37squamosa promoter binding protein-like 8